Skip to Content

ELISA Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

https://www.anagnostics.com/web/image/product.template/159040/image_1920?unique=b3f4f0f
(0 review)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 20µg Updated Date: Stock Protein updated on 20171018 Research areas: Others Target / Protein: apt Biologically active: Not Tested Expression system: BacµLovirus Species of origin: Streptococcus pyogenes serotype M1 Delivery time: 3-7 business days Uniprot ID: P63546 AA Sequence: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 1-172aa Protein length: FµLl Length MW: 22,7 Alternative Name(s): Relevance: Catalyzes a salvage reaction resµLting in the formation of AMP, that is energically less costly than de novo synthesis. Reference: "Evolutionary origin and emergence of a highly successfµL clone of serotype M1 group A Streptococcus involved mµLtiple horizontal gene transfer events." Sumby P., Porcella S.F., Madrigal A.G., Barbian K.D., Virtaneva K., Ricklefs S.M., Sturdevant D.E., Graham M.R., Vuopio-Varkila J., Hoe N.P., Musser J.M. J. Infect. Dis. 192:771-782(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

626.00 € 626.0 EUR 626.00 €

626.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.