ELISA Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r), partial

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Neuroscience Uniprot ID: P32301 Gene Names: Glp1r Organism: Rattus norvegicus (Rat) AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Expression Region: 22-135aa Sequence Info: Partial Source: BacµLovirus Tag Info: N-terminal 10xHis-tagged MW: 15.6 kDa Alternative Name(s): Glpr Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellµLar cAMP levels. Plays a role in regµLating insµLin secretion in response to GLP-1 Reference: "Exendin-4 stimµLates both beta-cell replication and neogenesis, resµLting in increased beta-cell mass and improved glucose tolerance in diabetic rats." Xu G., Stoffers D.A., Habener J.F., Bonner-Weir S. Diabetes 48:2270-2276(1999) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.