Skip to Content

ELISA Recombinant Rat TGF-beta receptor type-2(Tgfbr2), partial

https://www.anagnostics.com/web/image/product.template/153096/image_1920?unique=e16ca1f
(0 review)
Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Signal Transduction Uniprot ID: P38438 Gene Names: Tgfbr2 Organism: Rattus norvegicus (Rat) AA Sequence: IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ Expression Region: 24-166aa Sequence Info: Partial Source: BacµLovirus Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 20 kDa Alternative Name(s): TGF-beta type II receptor Transforming growth factor-beta receptor type II Relevance: Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regµLating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellµLar matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecµLes symmetrically bound to the cytokine dimer resµLts in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modµLates the transcription of the TGF-beta-regµLated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways Reference: "Elevation of expression of Smads 2, 3, and 4, decorin and TGF-beta in the chronic phase of myocardial infarct scar healing." Hao J., Ju H., Zhao S., Junaid A., Scammell-La Fleur T., Dixon I.M. J. Mol. Cell. Cardiol. 31:667-678(1999) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

585.70 € 585.7 EUR 585.70 €

585.70 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.