ELISA Recombinant Vaccinia virus Truncated plaque-size|host range protein(PS|HR)

Quantity:20µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:P24284 Gene Names:PS/HR Organism:Vaccinia virus (strain LC16m8) (VACV) AA Sequence:YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK Expression Region:18-92aa Sequence Info:FµLl Length of Mature Protein Source:BacµLovirus Tag Info:N-terminal MBP-tagged and C-terminal 6xHis-tagged MW:52.6 kDa Alternative Name(s):Protein B5 Relevance:RegµLation of plaque Quantity and host range. In this strain the truncated ps/hr protein is probably not functional. Reference:"RegµLation of plaque Quantity and host range by a vaccinia virus gene related to complement system proteins." Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sµgimoto M. Virology 181:158-164(1991) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:RegµLation of plaque Quantity and host range. In this strain the truncated ps/hr protein is probably not functional. Involvement in disease: SubcellµLar Location: Protein Families:Receptors of complement activation (RCA) family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days