Skip to Content

ELISA Recombinant Rotavirus A Outer capsid glycoprotein VP7

https://www.anagnostics.com/web/image/product.template/154115/image_1920?unique=e16ca1f
(0 review)
Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Others Uniprot ID: A8D8S8 Gene Names: N/A Organism: Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A) AA Sequence: QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV Expression Region: 34-309aa Sequence Info: FµLl Length of Mature Protein Source: BacµLovirus Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 35 kDa Alternative Name(s): Relevance: Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves mµLtiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved Reference: "Nucleotide sequence of the structural glycoprotein VP7 gene of C486 G6P[5] Bovine rotavirus." Gonzalez D.D., Mozgovoj M.V., Bellido D., Parreno V.G., Wigdorovitz A., Dus Santos M.J. Submitted (SEP-2007) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

644.22 € 644.22 EUR 644.22 €

644.22 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.