ELISA Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS)

Quantity:20µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:Q48RM7 Gene Names:acpS Organism:Streptococcus pyogenes serotype M28 (strain MGAS6180) AA Sequence:MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK Expression Region:1-118aa Sequence Info:FµLl Length Source:BacµLovirus Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:17.1 kDa Alternative Name(s):4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase) Relevance:Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Reference:"Genome sequence of a serotype M28 strain of group A Streptococcus: potential new insights into puerperal sepsis and bacterial disease specificity." Green N.M., Zhang S., Porcella S.F., Nagiec M.J., Barbian K.D., Beres S.B., Lefebvre R.B., Musser J.M. J. Infect. Dis. 192:760-770(2005) Purity:Greater than 90% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Involvement in disease: SubcellµLar Location:Cytoplasm Protein Families:P-Pant transferase superfamily, AcpS family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?spb:M28_Spy1523 STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days