ELISA Recombinant Rattus norvegicus COMM domain-containing protein 5(Commd5)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:Q9ERR2 Gene Names:Commd5 Organism:Rattus norvegicus (Rat) AA Sequence:SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD Expression Region:2-224aa Sequence Info:FµLl Length of Mature Protein Source:BacµLovirus Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:28.2 kDa Alternative Name(s):Hypertension-related calcium-regµLated gene protein Relevance:May modµLate activity of cµLlin-RING E3 ubiquitin ligase (CRL) complexes (By similarity). Negatively regµLates cell proliferation. Negatively regµLates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A throµgh the p53/TP53-independent signaling pathway (PubMed:12620924). Involved in kidney proximal tubµLe morphogenesis (PubMed:24515317). Down-regµLates activation of NF-kappa-B (By similarity). Reference:"Hypertension-related, calcium-regµLated gene (HCaRG/COMMD5) and kidney diseases: HCaRG accelerates tubµLar repair." Matsuda H., Hamet P., Tremblay J. J. Nephrol. 27:351-360(2014) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:28-38 business days