ELISA Recombinant Rabbit Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:P30357 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQEAVGNVVLLAIVTLISVVQNGFFAHKVEHESRNQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSLAGILNYCLILLFGSDFENYIKTISTT Protein Names:Recommended name: Arachidonate 5-lipoxygenase-activating protein Alternative name(s): FLAP MK-886-binding protein Gene Names:Name:ALOX5AP Synonyms:FLAP Expression Region:1-153 Sequence Info:FµLl length protein