ELISA Recombinant Sheep Aquaporin-1(AQP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P56401 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ASEFKKKLFWRAVVAEFLAMILFIFISIGSALGFHYPIKSNQTTGAVQDNVKVSLAFGLS IATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAIMYIIAQCVGAIVATVILSGITSSL PDNSLGLNALAPGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRRDLGDSGPLAIGFSVAL GHLLAIDYTGCGINPARSFGSSVITHNFQDHWIFWVGPFIGAALAVLIYDFILAPRSSDL TDRVKVWTSGQVEEYDLDADDINSRVEMKPK Protein Names:Recommended name: Aquaporin-1 Short name= AQP-1 Alternative name(s): Aquaporin-CHIP Water channel protein for red blood cells and kidney proximal tubµLe Gene Names:Name:AQP1 Expression Region:2-272 Sequence Info:FµLl length protein