Skip to Content

ELISA Recombinant Rat V-type proton ATPase subunit S1(Atp6ap1)

https://www.anagnostics.com/web/image/product.template/153262/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O54715 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VAAEQQVPLVLWSSDRDLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLESEDVPYT AALTAVRPSRVARDVAMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAY KDEWKDLTSLTFGVENLNLTGSFWNDSFAmLSLTYEPLFGATVTFKFILASRFYPVSARY WFTMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHN FQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFmLFIFTYGLHMILSLKTMDRFDDR KGPTITLTQIV Protein Names:Recommended name: V-type proton ATPase subunit S1 Short name= V-ATPase subunit S1 Alternative name(s): C7-1 protein V-ATPase Ac45 subunit V-ATPase S1 accessory protein Vacuolar proton pump subunit S1 Gene Names:Name:Atp6ap1 Synonyms:Atp6ip1, Atp6s1 Expression Region:33-463 Sequence Info:FµLl length protein

1,790.00 € 1790.0 EUR 1,790.00 €

1,790.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.