ELISA Recombinant Solanum lycopersicum V-type proton ATPase 16 kDa proteolipid subunit
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Solanum lycopersicum (Tomato) (Lycopersicon escµLentum)
Uniprot NO.:O24011
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNFAGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV RANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit
Gene Names:
Expression Region:1-164
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.