Skip to Content

ELISA Recombinant Rat Vasopressin V2 receptor(Avpr2)

https://www.anagnostics.com/web/image/product.template/151865/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q00788 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM VGMYASSYMILAMTLDRHRAICRPmLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA PLERPPFVLLmLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT ASSSLMKDTPS Protein Names:Recommended name: Vasopressin V2 receptor Short name= V2R Alternative name(s): AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor Gene Names:Name:Avpr2 Expression Region:1-371 Sequence Info:fµLl length protein

1,727.00 € 1727.0 EUR 1,727.00 €

1,727.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.