ELISA Recombinant Rat Beta-1,3-galactosyltransferase 4(B3galt4)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:O88178
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRVGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS
Protein Names:Recommended name: Beta-1,3-galactosyltransferase 4 Short name= Beta-1,3-GalTase 4 Short name= Beta3Gal-T4 Short name= Beta3GalT4 Short name= b3Gal-T4 EC= 2.4.1.62 Alternative name(s): Gal-T2 Ganglioside galactosyltransferase UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase
Gene Names:Name:B3galt4
Expression Region:1-371
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.