Skip to Content

ELISA Recombinant Rat Beta-1,3-galactosyltransferase 4(B3galt4)

https://www.anagnostics.com/web/image/product.template/151986/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O88178 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRVGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS Protein Names:Recommended name: Beta-1,3-galactosyltransferase 4 Short name= Beta-1,3-GalTase 4 Short name= Beta3Gal-T4 Short name= Beta3GalT4 Short name= b3Gal-T4 EC= 2.4.1.62 Alternative name(s): Gal-T2 Ganglioside galactosyltransferase UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase Gene Names:Name:B3galt4 Expression Region:1-371 Sequence Info:fµLl length protein

1,727.00 € 1727.0 EUR 1,727.00 €

1,727.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.