ELISA Recombinant Rat Bcl-2-like protein 1(Bcl2l1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P53563 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK Protein Names:Recommended name: Bcl-2-like protein 1 Short name= Bcl2-L-1 Alternative name(s): Apoptosis regµLator Bcl-X Gene Names:Name:Bcl2l1 Synonyms:Bclx, Blc2l Expression Region:1-233 Sequence Info:FµLl length protein