ELISA Recombinant Rat BET1-like protein(Bet1l)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O35152 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MADWTRAQSSGAVEEIVDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTVARSGRDTRKLLCGMAVVLIVAFFILSYLFSRTRT Protein Names:Recommended name: BET1-like protein Alternative name(s): Golgi SNARE with a Quantity of 15 kDa Short name= GOS-15 Short name= GS15 Vesicle transport protein GOS15 Gene Names:Name:Bet1l Synonyms:Gs15 Expression Region:1-111 Sequence Info:fµLl length protein