ELISA Recombinant Xenopus tropicalis Fat storage-inducing transmembrane protein 2(fitm2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:A0JP80 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERLENCAQMFQRRFLNESFRRHCPVLLACIVLGGSLLKELCPLPDSYWNNKRNVLNVYF VKFSWGWTLWLLLPFIALTNYKLTRSTTKVLRRLSSLLVSTLIWYLCTNLFLYIENITGS CYESEAMSDPKEHQDRRECRLHSGYWHGFDISGHCFLLSYCILLILEETSIISNIRFERH WHRMAINAQFAALSILVIIWVWMFLCTAVYFHNIFQKVIGTAFGILAWYITYRWWYLQPI SPGLPPASASRSGKEPIYRN Protein Names:Recommended name: Fat storage-inducing transmembrane protein 2 Alternative name(s): Fat-inducing protein 2 Gene Names:Name:fitm2 Expression Region:1-260 Sequence Info:fµLl length protein