ELISA Recombinant Trachypithecus francoisi C-C chemokine receptor type 5(CCR5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trachypithecus francoisi (Francois's leaf monkey) (Presbytis francoisi) Uniprot NO.:O97878 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQETSVGL Protein Names:Recommended name: C-C chemokine receptor type 5 Short name= C-C CKR-5 Short name= CC-CKR-5 Short name= CCR-5 Short name= CCR5 Alternative name(s): CD_antigen= CD195 Gene Names:Name:CCR5 Synonyms:CMKBR5 Expression Region:1-352 Sequence Info:fµLl length protein