Skip to Content

ELISA Recombinant Trachypithecus phayrei C-C chemokine receptor type 5(CCR5)

https://www.anagnostics.com/web/image/product.template/160081/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trachypithecus phayrei (Phayre's leaf monkey) Uniprot NO.:O97879 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL Protein Names:Recommended name: C-C chemokine receptor type 5 Short name= C-C CKR-5 Short name= CC-CKR-5 Short name= CCR-5 Short name= CCR5 Alternative name(s): CD_antigen= CD195 Gene Names:Name:CCR5 Synonyms:CMKBR5 Expression Region:1-352 Sequence Info:fµLl length protein

1,707.00 € 1707.0 EUR 1,707.00 €

1,707.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.