ELISA Recombinant Rat OX-2 membrane glycoprotein(Cd200)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P04218 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QVEVVTQDERKLLHTTASLRCSLKTTQEPLIVTWQKKKAVGPENMVTYSKAHGVVIQPTYKDRINITELGLLNTSITFWNTTLDDEGCYMCLFNMFGSGKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGSGIENSTESHSHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK Protein Names:Recommended name: OX-2 membrane glycoprotein Alternative name(s): MRC OX-2 antigen CD_antigen= CD200 Gene Names:Name:Cd200 Synonyms:Mox2 Expression Region:31-278 Sequence Info:fµLl length protein