ELISA Recombinant Sheep T-cell surface glycoprotein CD3 zeta chain(CD247)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P29329 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QSFGLLDPKLCYLLDGILFIYGVIVTALFLRAKFSRSADAPAYQHGQNPVYNELNVGRREEYAVLDRRGGFDPEMGGKPQRKKNPHEVVYNELRKDKMAEAYSEIGMKSDNQRRRGKGHDGVYQGLSTATKDTYDALHMQALPPR Protein Names:Recommended name: T-cell surface glycoprotein CD3 zeta chain Alternative name(s): T-cell receptor T3 zeta chain CD_antigen= CD247 Gene Names:Name:CD247 Synonyms:CD3Z Expression Region:22-166 Sequence Info:fµLl length protein