ELISA Recombinant Trichosurus vulpecula CD302 antigen(CD302)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trichosurus vµLpecµLa (Brush-tailed possum) Uniprot NO.:A8WH72 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DCPSSSWVQFQSNCYIFLQTTVKIENIEDVRNQCTDSASGADMISIHNEEENAFILETFKKRWKAQDDILLGMFYDTDDESFKWYDKSNMTFNKWKNSEESQDLIDTCGFLQPKSGIWKKGNCEVSSVEGALCKAAVSYEKKYLPDHHILITALVIASTTILTITGAVVWFLYKRNLTSGLTNTAYTTAPQLPYNDDCILVDAEENEYVA Protein Names:Recommended name: CD302 antigen Alternative name(s): Type I transmembrane C-type lectin receptor DCL-1 Gene Names:Name:CD302 Expression Region:22-231 Sequence Info:fµLl length protein