ELISA Recombinant Rat T-cell surface glycoprotein CD3 delta chain(Cd3d)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P19377 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FKIEVVEYEDKVFVNCNTSIRHLDGSVERWLTKNKSLILGKGILDPRGMYMCNGTEELAKEVSTVQVYYRMCQNCVELDSATLAGVIITDLIATLLLALGVYCFAGHETGRLSGAVDTQVLLKNEQLYQPLRDRDDAQYSRLGGNWPRNKRS Protein Names:Recommended name: T-cell surface glycoprotein CD3 delta chain Alternative name(s): T-cell receptor T3 delta chain CD_antigen= CD3d Gene Names:Name:Cd3d Synonyms:T3d Expression Region:22-173 Sequence Info:fµLl length protein