ELISA Recombinant Rat Leukocyte surface antigen CD47(Cd47)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P97829 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTRE QNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGAILFIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNN Protein Names:Recommended name: Leukocyte surface antigen CD47 Alternative name(s): Integrin-associated protein Short name= IAP CD_antigen= CD47 Gene Names:Name:Cd47 Expression Region:19-303 Sequence Info:FµLl length protein