ELISA Recombinant Rat Leukocyte surface antigen CD47(Cd47)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P97829
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTRE QNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELSREGKTVIELKNRPVSWFSTN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGAILFIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNN
Protein Names:Recommended name: Leukocyte surface antigen CD47 Alternative name(s): Integrin-associated protein Short name= IAP CD_antigen= CD47
Gene Names:Name:Cd47
Expression Region:19-303
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.