ELISA Recombinant Rat Leukocyte surface antigen CD53(Cd53)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P24485
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGS IIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDS IQHYHSDNSTRMAWDFIQSQLQCCGVNGSSDWISGPPSSCPSGADVQGCYKKGQAWFHSN FLYIGIVTICVCVIQVLGMSFALTLNCQIDKTSQALGL
Protein Names:Recommended name: Leukocyte surface antigen CD53 Alternative name(s): Cell surface glycoprotein CD53 Leukocyte antigen MRC OX-44 CD_antigen= CD53
Gene Names:Name:Cd53 Synonyms:Ox-44
Expression Region:2-219
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.