ELISA Recombinant Rat Leukocyte surface antigen CD53(Cd53)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P24485 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGS IIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDS IQHYHSDNSTRMAWDFIQSQLQCCGVNGSSDWISGPPSSCPSGADVQGCYKKGQAWFHSN FLYIGIVTICVCVIQVLGMSFALTLNCQIDKTSQALGL Protein Names:Recommended name: Leukocyte surface antigen CD53 Alternative name(s): Cell surface glycoprotein CD53 Leukocyte antigen MRC OX-44 CD_antigen= CD53 Gene Names:Name:Cd53 Synonyms:Ox-44 Expression Region:2-219 Sequence Info:FµLl length protein