ELISA Recombinant Rabbit T-lymphocyte activation antigen CD80(CD80)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Oryctolagus cunicµLus (Rabbit)
Uniprot NO.:P42070
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG
Protein Names:Recommended name: T-lymphocyte activation antigen CD80 Alternative name(s): Activation B7-1 antigen CD_antigen= CD80
Gene Names:Name:CD80
Expression Region:33-299
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.