ELISA Recombinant Pongo pygmaeus T-cell surface glycoprotein CD8 alpha chain(CD8A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:P30433 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSERYV Protein Names:Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen= CD8a Gene Names:Name:CD8A Expression Region:22-198 Sequence Info:fµLl length protein