ELISA Recombinant Xenopus tropicalis CD99 antigen-like protein 2(cd99l2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:B1H3G4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DDFDLYDALGDPTEKPKPKPPKPPKSPTHDSGDLDLSDFFDTPVKTTTKSPRLPPKQPDLRFSTTTKKPRTTKIPPKKSDPNDFDLSDALDGNNGKGDISDSDLDDILNDGYNPDKKKGGGGGGGGGGRATGQGDNDGSDTGFGSQAETGTIAGIASALAMALIGAVSSYISYQQKKFCFSIQEGLNAEYVKGEHMEAVVSEEPQVKYSVVESQSAIP Protein Names:Recommended name: CD99 antigen-like protein 2 Alternative name(s): CD_antigen= CD99 Gene Names:Name:cd99l2 Expression Region:24-241 Sequence Info:fµLl length protein