ELISA Recombinant Saccharomyces cerevisiae CDP-diacylglycerol--inositol 3-phosphatidyltransferase(PIS1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P06197 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDG TMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLmLGLDITSHYMHMYA SLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTT IISFPGYVFKQTANVVQLKRAALILADNDAKNANEKNKTY Protein Names:Recommended name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase EC= 2.7.8.11 Alternative name(s): Phosphatidylinositol synthase Short name= PI synthase Short name= PtdIns synthase Gene Names:Name:PIS1 Synonyms:PIS Ordered Locus Names:YPR113W ORF Names:P8283.5 Expression Region:1-220 Sequence Info:fµLl length protein