ELISA Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40(mia40)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P87059 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AASLTAGYLLGKNTSNASSSQDNDHPVVGEHVHTETQSYNEPYMQRHRIEDAIEKKMTSE TQPSTDEKGRKVSATENSAPKKTDKEKSSGETAGNILREQIATGKDDDEYARKFEEVEEE SSEESAFNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSKSEPKGMECLDKFQAMQ ACFQKHPEIYQDMVGESEEEDAETNEKPSTTSDENNQPQSPPSDNASNPEEDVMNMEKEI VNLTPMSVIKEI Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40 Gene Names:Name:mia40 Synonyms:tim40 ORF Names:SPAC57A10.11c Expression Region:62-313 Sequence Info:fµLl length protein