ELISA Recombinant Rat CDGSH iron-sulfur domain-containing protein 1(Cisd1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:B0K020 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET Protein Names:Recommended name: CDGSH iron-sµLfur domain-containing protein 1 Alternative name(s): MitoNEET Gene Names:Name:Cisd1 Expression Region:2-108 Sequence Info:fµLl length protein