Skip to Content

ELISA Recombinant Salmonella paratyphi B Cardiolipin synthase(cls)

https://www.anagnostics.com/web/image/product.template/155745/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) Uniprot NO.:A9MWP9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLmLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL Protein Names:Recommended name: Cardiolipin synthase Short name= CL synthase EC= 2.7.8.- Gene Names:Name:cls Ordered Locus Names:SPAB_01504 Expression Region:1-486 Sequence Info:fµLl length protein

1,848.00 € 1848.0 EUR 1,848.00 €

1,848.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.