ELISA Recombinant Rat C-X-C chemokine receptor type 5(Cxcr5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P34997 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSPISLDMGAITYNMDDLYKELAIYSNSTEIPLQDSIFCSTEEGPLLTSFKTIFMPVAY SLIFLLGMMGNILVLVILERHRHTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLG TFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRRRRLLSIHITCSTIWLAGF LFALPELLFAKVVQPHNNESLPQCIFSQENEAETRAWFASRFLYHTGGFLLPmLVMAWCY VGVVHRLLQAQRRPQRQKAVRVAILVTSIFLLCWSPYHIVIFLDTLERLKAVNSSCELSG YLSVAITLCEFLGLAHCCLNPmLYTFAGVKFRSDLSRLLTKLGCAGPASLCQLFPGWRKS SLSESENATSLTTF Protein Names:Recommended name: C-X-C chemokine receptor type 5 Short name= CXC-R5 Short name= CXCR-5 Alternative name(s): Burkitt lymphoma receptor 1 homolog Neurolymphatic receptor Short name= NLR CD_antigen= CD185 Gene Names:Name:Cxcr5 Synonyms:Blr1 Expression Region:1-374 Sequence Info:FµLl length protein