ELISA Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1(CBR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7TNL7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAESMNKIFIAIIAIAVAAAATKMFTSEEPKSKALPVLVKGEYMQFPLVSIKKLNRNSAIYRFKLPTDEHVLGLPIGQHITIKAHIDGSEVVRSYTPISLDSEAKGYFELLIKSYEQGKISKMFTSLKIGDTIDVQGPKGFYEYTDRSSKHLAMIAGGSGLTPMYQIIKSIAENPKDKTKVTFIYGNVEEIDILLRDDLDKFAASKPGQITIHYLLDKPSENWKGGSGYVTPELMKEKLPAPADGVQLLVCGPLPMVSAIKRSAVALGFPKAKPVSKMNDQVFVF Protein Names:Recommended name: NADH-cytochrome b5 reductase 1 EC= 1.6.2.2 Alternative name(s): Microsomal cytochrome b reductase Gene Names:Name:CBR1 ORF Names:Kpol_1070p17 Expression Region:1-285 Sequence Info:fµLl length protein