ELISA Recombinant Saccharomyces cerevisiae NADH-cytochrome b5 reductase 2(MCR1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast) Uniprot NO.:A6ZZH2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ESNKVFKGDDKWIDLPISKIEEESHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSN VVRPYTPVSDLSQKGHFQLVVKHYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKS ITLLGAGTGINPLYQLAHHIVENPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFN VTYFVDDKQDDQDFDGEIGFISKDFIQEHVPGPKESTHLFVCGPPPFMNAYSGEKKSPKD QGELIGILNNLGYSKDQVFKF Protein Names:Recommended name: NADH-cytochrome b5 reductase 2 EC= 1.6.2.2 Alternative name(s): Mitochondrial cytochrome b reductase p34/p32 Cleaved into the following 2 chains: 1. NADH-cytochrome b5 reductase p34 form 2. NADH-cytochrome b5 r Gene Names:Name:MCR1 ORF Names:SCY_3232 Expression Region:42-302 Sequence Info:fµLl length protein