ELISA Recombinant Scheffersomyces stipitis NADH-cytochrome b5 reductase 2(MCR1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) Uniprot NO.:A3LT66 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFSRSFSRLASSKFVLPVAAAAVGLASYSFTSSSFIANEPSKAFKGGDEWIDLKLISSH DLSHDTKHLVFELPNKDDVSGLVTASLLMTKFVTPKGSNVIRPYTPVSDTEQAGTIDFVV KKYEGGKMSSHIHDLKPNDTLSFKGPFVKWKWEPNQFKSIALIGGGTGITPLYQLIHEIT KNPADKTQVSLFYGSQTPDDILIKKELDALAAKHKDQVKIVYFVDKADASWKGETGYISK EFLQKNLPAPGPDNKIFVCGPPPLYKAVSGPKVSPTDQGELTGSLAELGFSKENVFKF Protein Names:Recommended name: NADH-cytochrome b5 reductase 2 EC= 1.6.2.2 Alternative name(s): Mitochondrial cytochrome b reductase Gene Names:Name:MCR1 ORF Names:PICST_44816 Expression Region:1-298 Sequence Info:fµLl length protein