ELISA Recombinant Pongo abelii Cytochrome b reductase 1(CYBRD1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RAJ4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAMEGYWRFLALLGSALLVGFLSVIFTLVWVLHYREGLGWDGSALEFNWHPVLMVTGFVF IQGIAIIVYRLSWTWKCSKLLMKSIHAGLNAVAAILAVISVVAVFENHNVNNIANMYSLH SWVGLIAVICYLLQLLAGFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGVTE KLIFSLRDPAYSTFPPEGVFFVNTLGLLILVFGALIFWIVTRPQWKRPKEPDSTILHPSG GTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM Protein Names:Recommended name: Cytochrome b reductase 1 EC= 1.-.-.- Alternative name(s): Duodenal cytochrome b Gene Names:Name:CYBRD1 Expression Region:1-287 Sequence Info:fµLl length protein