ELISA Recombinant Rhodobacter capsulatus Cytochrome c1(petC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (Rhodopseudomonas capsµLata) Uniprot NO.:P0CY49 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NSNVQDHAFSFEGIFGKFDQAQLRRGFQVYSEVCSTCHGMKFVPIRTLSDDGGPQLDPTF VREYAAGLDTIIDKDSGEERDRKETDMFPTRVGDGMGPDLSVMAKARAGFSGPAGSGMNQ LFKGIGGPEYIYRYVTGFPEENPACAPEGIDGYYYNEVFQVGGVPDTCKDAAGIKTTHGS WAQMPPALFDDLVTYEDGTPATVDQMGQDVASFLMWAAEPKLVARKQMGLVAVVmLGLLS VmLYLTNKRLWAPYKRQKA Protein Names:Recommended name: Cytochrome c1 Gene Names:Name:petC Expression Region:22-280 Sequence Info:fµLl length protein