ELISA Recombinant Pisum sativum Defender against cell death 1(DAD1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pisum sativum (Garden pea) Uniprot NO.:Q9ZRA3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKTSSTTKDAQDLFHAIWSAYSATPTNLKIIDLYVVFAVFTALLQDVYMALVGPFPFNS FLSGVLSCVGTAVLAVCLRIQVNKENKEFKDLGPERAFADFVLCNLVLHLVIMNFLG Protein Names:Recommended name: Defender against cell death 1 Short name= DAD-1 Alternative name(s): Peadad Gene Names:Name:DAD1 Expression Region:1-117 Sequence Info:fµLl length protein