ELISA Recombinant Xenopus laevis Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1(dad1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P46967 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVSVFSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGF ISSVGSFILAVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVVNFIG Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 Short name= Oligosaccharyl transferase subunit dad1 EC= 2.4.1.119 Alternative name(s): Defender against cell death 1 Short name= DAD Gene Names:Name:dad1 Expression Region:1-113 Sequence Info:fµLl length protein