Skip to Content

ELISA Recombinant Ustilago maydis Dolichol-phosphate mannosyltransferase(DPM1)

https://www.anagnostics.com/web/image/product.template/160371/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:P54856 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSIALDMDASAKMRKQPGSSGWSTSSTPSCSVIVPAFRENLNLRPLVTRLSSAFASQSSS ELANTEIIIVDDNSRDGSVETVSALQSEGYNVRIIVRTSERGLSSAVVRGFREARGQRMI CMDADLQHPPEAVPSLLLALNGQKSFVLGTRYGVGVSMDKDWPLHRRIISSGARmLARPL TSASDPMSGFFGITKHSFHTADHHINAQGFKIALDLLVKSGVHSTDIAEVPFSFGLRQEG ESKLDGKVMFKYLQQLVELYRFRFGTVPIVFVLIVLLVLALYIWSHVLAPmLGA Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase EC= 2.4.1.83 Alternative name(s): Dolichol-phosphate mannose synthase Short name= DPM synthase Dolichyl-phosphate beta-D-mannosyltransferase Mannose-P-dolichol synthase Gene Names:Name:DPM1 ORF Names:UM06329 Expression Region:1-294 Sequence Info:fµLl length protein

1,645.00 € 1645.0 EUR 1,645.00 €

1,645.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.