ELISA Recombinant Rabbit D(1A) dopamine receptor(DRD1)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Oryctolagus cunicµLus (Rabbit)
Uniprot NO.:O02664
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:NTLLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIW VAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILIGVAWTLSVLISFIPV QLSWHKAKPTSPPDGNATSLDETVDNCDSSLSRTYSISSSLVNFYNPVAIMXVTYTRIHR
Protein Names:Recommended name: D(1A) dopamine receptor Alternative name(s): Dopamine D1 receptor
Gene Names:Name:DRD1
Expression Region:1-180
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.