ELISA Recombinant Rabbit Epithelial membrane protein 1(EMP1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:P54850 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLVLLAAIFVVHIATCVmLFVSTIANVWVVSDSINASVGLWRNCTSGDCSGGLSYGHEDA LKAVQAFMILSIIFSVISLIIFVFQLFTMEKGNRFFLSGATmLVCWLCVLIGASIYTHRY ANGDSNTFDRSHHGYSFILAWICFCFSFVVGVLYLVLRKK Protein Names:Recommended name: Epithelial membrane protein 1 Short name= EMP-1 Alternative name(s): Squamous cell-specific protein CL-20 Tumor-associated membrane protein Gene Names:Name:EMP1 Expression Region:1-160 Sequence Info:FµLl length protein