ELISA Recombinant Rat Epithelial membrane protein 3(Emp3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9QYW5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSEN GWLKAVQALMVLSLILCCLSFILFMIQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAI HAKEILAKHPSGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE Protein Names:Recommended name: Epithelial membrane protein 3 Short name= EMP-3 Gene Names:Name:Emp3 Expression Region:1-163 Sequence Info:fµLl length protein