ELISA Recombinant Rat Tumor necrosis factor ligand superfamily member 6(Faslg)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P36940
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQPPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 6 Alternative name(s): CD95 ligand Short name= CD95-L Fas antigen ligand Short name= Fas ligand Short name= FasL CD_antigen= CD178 Cleaved into the following 4 chains: 1. Tumor necrosis factor ligand superfamily member 6, membrane form 2. Tumor necrosis factor ligand superfamily member 6, soluble form Alternative name(s): Receptor-binding FasL ectodomain Soluble Fas ligand Short name= sFasL ADAM10-processed FasL form Short name= APL FasL intracellµLar domain Short name= FasL ICD Alternative name(s): SPPL2A-processed FasL form Short name= SPA
Gene Names:Name:Faslg Synonyms:Apt1Lg1, Cd95l, Fasl, Tnfsf6
Expression Region:1-278
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.