ELISA Recombinant Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P12371 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG Protein Names:Recommended name: High affinity immunoglobµLin epsilon receptor subunit alpha Alternative name(s): Fc-epsilon RI-alpha Short name= FcERI IgE Fc receptor subunit alpha Gene Names:Name:Fcer1a Synonyms:Fce1a Expression Region:24-245 Sequence Info:fµLl length protein