ELISA Recombinant Rat Mitochondrial fission 1 protein(Fis1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P84817 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Protein Names:Recommended name: Mitochondrial fission 1 protein Alternative name(s): FIS1 homolog Short name= rFis1 Tetratricopeptide repeat protein 11 Short name= TPR repeat protein 11 Gene Names:Name:Fis1 Synonyms:Ttc11 Expression Region:1-152 Sequence Info:fµLl length protein