Skip to Content

ELISA Recombinant Rabbit Dimethylaniline monooxygenase [N-oxide-forming] 4(FMO4)

https://www.anagnostics.com/web/image/product.template/151556/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:P36367 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKKVAVIGAGVSGLTSIKCCLDEDLEPTCFERSNDIGGLWKYTETSKDGMTRIYWSLVTN VCKEMSCYSDFPFQEDYPNFMSHSKFWNYLQEFAEHFDLLKYIQFKTTVCSVTKRPDFSK TGQWDVVTETEGKQHRAVFDAVMVCTGKFLNPRLPLESFPGILKFRGQILHCQEYKIPEG FRGQRVLVIGLGNSGGDVAVELSRVAAQVLLSTRTGTWVISRSSNGGYPFNMMITRRCLN VIEQVLPSCFLRWINERQMNKRFNHENYGLSITKGKNPKFIVNDELPTCILCGTVTVKTS VKEFTETSAIFEDGTVEENIDSVIFTTGYVFSFPFLEEPLRSLCMKKMFLYKHVFPSNLE RASMAIIGLISLKGSILTGTELQARWATRVFKGLCKIPPPQQLMAEVTKKEELIKRGVIK DTSEEKLSYIPYMDDLAACIGTKPNIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWDG ARNAILTQWDRTLKPLKTRTVSSDSSKSASLSHYLKVWGAPLLLASVLLICKSSHFLKSV RDKLQNRIFPYLVL Protein Names:Recommended name: Dimethylaniline monooxygenase [N-oxide-forming] 4 EC= 1.14.13.8 Alternative name(s): Dimethylaniline oxidase 4 FMO 1E1 Hepatic flavin-containing monooxygenase 4 Short name= FMO 4 Gene Names:Name:FMO4 Expression Region:2-555 Sequence Info:FµLl length protein

1,920.00 € 1920.0 EUR 1,920.00 €

1,920.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.