ELISA Recombinant Pongo pygmaeus N-formyl peptide receptor 2(FPR2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:P79236 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NFSTPLNEHEEVSYESAGYTVLQILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTIC YLNLPLADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDR CICVLHPVWAQNHRTVSLAMKVIIGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASW GGTPEERKNVAITmLTARGIIRFVIGFSMPMSIVAICYGLIAAKIHKKGMIKSSRPLRVL TAVVASFFICWFPFQLVALLSTVWLKEmLFYGKYKIINILVNPTSSLAFFNSCLNPmLYV FVGQDFRERLIRSLPTSLERALSEDSAPTNDTAAKCASPPAETELQAM Protein Names:Recommended name: N-formyl peptide receptor 2 Alternative name(s): FmLP-related receptor I Short name= FmLP-R-I Formyl peptide receptor-like 1 Gene Names:Name:FPR2 Synonyms:FPRL1 Expression Region:1-348 Sequence Info:fµLl length protein