ELISA Recombinant Pongo pygmaeus N-formyl peptide receptor 3(FPR3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:P79237 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METNFSIPLNESEEVLPEPAGHTVLWIFSLLVHGVTFIFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFRMVSVAMREKWPFGTFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMMGLWILAIVLTLPNFIFWTTISTKNGDTYCIFNF PFWGDTAVERLNAFITMGKVFLILHFIIGFSMPMSIITVCYGIIAAKIHRNHMIKSSSPL RVFAAVVASFFICWFPYELIGILMAVWLKEmLLNGKYKIILVLLNPTSSLAFFNSCLNPI LYVFLGSNFQERLIRSLPTSLERALTEVPDSAQTSNTHTNSASPPEETE Protein Names:Recommended name: N-formyl peptide receptor 3 Alternative name(s): FmLP-related receptor II Short name= FmLP-R-II Formyl peptide receptor-like 2 Gene Names:Name:FPR3 Synonyms:FPRL2 Expression Region:1-349 Sequence Info:fµLl length protein