ELISA Recombinant Rat Phospholemman(Fxyd1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O08589 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:EAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR Protein Names:Recommended name: Phospholemman Alternative name(s): FXYD domain-containing ion transport regµLator 1 Gene Names:Name:Fxyd1 Synonyms:Plm Expression Region:21-92 Sequence Info:fµLl length protein